PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01807.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 573aa    MW: 64469.6 Da    PI: 4.5255
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01807.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-51321582128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              ppGfrFhPtdeelv +yLk+k+ ++++ l ++i+evd+yk+eP+dLp  +k+k+++++w+fFs+rd+ky++g r+nr  k+gyWka
  Sme2.5_01807.1_g00001.1  32 PPGFRFHPTDEELVLYYLKRKICRRRILL-DAIAEVDVYKWEPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARSNRGSKHGYWKA 116
                              9*************************999.99**************96559999***********************99******* PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgkd+++++ ++++vg+kktLvfykgrap ge+tdWvmhey++
  Sme2.5_01807.1_g00001.1 117 TGKDRTITC-NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 158
                              *********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5927181IPR003441NAC domain
PROSITE profilePS5100555.80431181IPR003441NAC domain
PfamPF023651.3E-2632157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MRLLMNSSGP SSSSPCKEVK VSECFGENSV FPPGFRFHPT DEELVLYYLK RKICRRRILL  60
DAIAEVDVYK WEPEDLPDLS KLKTGDRQWF FFSPRDRKYP NGARSNRGSK HGYWKATGKD  120
RTITCNSRAV GVKKTLVFYK GRAPVGERTD WVMHEYTMDE EELKRCQNVQ DYYALYKVFK  180
KSGPGPKNGE QYGAPFREED WIDDECLNPK VSVEEESPRL QENSPKPINV VPAADDVLEE  240
LLNRIADEPV PFEPFTVDNN FALEQFLQEE DTESTLLNQS SREVNLYNHC AVAGPSCQPY  300
NAKTSFDLTE SGTSLLHLHE APEVSSAPVN PKKPPYILEE DFLEDFLEMD DLLVPEPTVQ  360
NFDHQTSNGQ VFAKHAGNLE TLQFDGFDGL TEFDLYHDAP SLLDNEGIPT VGQIAEPYAN  420
NFVNGITCAD STTYMSTFQN DMMNNQQMQL NHENQISNQF WTHDGKFGVF NSIEGDQSVV  480
DQATSGVVYD NNMANHPMGA NQNLAKKDDG TQSWFSSNLW SFVDSIPTTP ASAAESALVV  540
NRAFERMSSF SRLKLNVGNM NVAAGTSAKM AGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-483115815140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4375230.0KF437523.1 Solanum tuberosum putative membrane bound NAC transcription factor 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074110.10.0PREDICTED: NAC domain-containing protein 17-like
TrEMBLU5Q2T90.0U5Q2T9_SOLTU; Putative membrane bound NAC transcription factor 2
STRINGSolyc04g072220.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-114NAC domain containing protein 17